PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco016892.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 376aa    MW: 41325.9 Da    PI: 6.3638
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco016892.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox231.4e-073243572154
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  k +yp+++++++L +++gL+ +q+ +WF N+R +
  Aco016892.1 324 KWPYPTEDDKARLVQETGLQLKQINNWFINQRKR 357
                  569*****************************87 PP

2ELK292.4e-10278299122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELKh+L+++Y+++++++++E++
  Aco016892.1 278 ELKHELKQGYKEKIVDIREEIL 299
                  9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.5E-18113157IPR005540KNOX1
PfamPF037902.1E-16116156IPR005540KNOX1
SMARTSM012561.3E-25166221IPR005541KNOX2
PfamPF037911.1E-17173220IPR005541KNOX2
PROSITE profilePS512139.969278298IPR005539ELK domain
SMARTSM011886.1E-4278299IPR005539ELK domain
PfamPF037898.5E-7278299IPR005539ELK domain
PROSITE profilePS5007111.418298361IPR001356Homeobox domain
SuperFamilySSF466895.13E-16300364IPR009057Homeodomain-like
SMARTSM003896.9E-11300365IPR001356Homeobox domain
CDDcd000862.63E-11301360No hitNo description
Gene3DG3DSA:1.10.10.603.1E-25305363IPR009057Homeodomain-like
PfamPF059201.1E-17318357IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MGMIYSDSDS VSTLSSSSSS PPQSPYTQAI YVRQGGKTPC WTTRAPPTTT TTMAASYPNH  60
PVSHDMIYAD HDDDGDGGGG GGGGGPAWLL RHHHGGGGGD GEEEAAEGGG GRRREKGEIV  120
RHPLFEQLLS AHVACLRVAT PVDQLPRIDA QLAQSHHVVA RYSVLGDGAD AVDRGLDHFM  180
THYVLLLCSF KEQLQQHVRV HAMEAVMACW ELEQSLQNLT GVSPGEGSGA TMSDDDDEQA  240
DSDTNLFDQG FDGPDSMGFG PLVPTETERC LMERVRQELK HELKQGYKEK IVDIREEILR  300
KRRAGKLPGD TTSVLKAWWQ AHSKWPYPTE DDKARLVQET GLQLKQINNW FINQRKRNWH  360
TSLSSSTASK SKRKR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1354374RKRNWHTSLSSSTASKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6626561e-164KM662656.1 Ananas bracteatus clone 46550a microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136985.11e-167hypothetical protein PHAVU_009G090500g
SwissprotP480001e-161KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLV7ATS51e-167V7ATS5_PHAVU; Uncharacterized protein
STRINGGSMUA_Achr7P05170_0011e-163(Musa acuminata)
STRINGGLYMA17G32980.11e-163(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-145KNOTTED1-like homeobox gene 3